Parasparam serial last episode climax parasparam deepthi bomb blast scene parasparam last episode troll video parasparam end scene asianet serial parasparam last episode. Parasparam watch episode 17 deepthi saves the marriage. On insistence from his parents and spouse sandhya, gopan accepts the truth that deepthi will pursue her ambitions. Parasparam 010917, asianet tv serial parasparam 2017 september 1 episode no 1245, parasparam sep 09 watch online. Vivek gopan and gayathri arun parasparam serial actress and actor. Padmavathy feels depressed as deepthi s arrival for the wedding gets doubtful. Parasparam 18 december 2017 to 23 december 2017 complete episodes 33 to 38 asianet parasparam serial 18122017 to 23122017 youtube hotstar videos admin 10. Parasparam 8 april 2016 8 4 16 asianet tv serial episode. Asianet serial parasparam is a superhit serial telecasting from monday to saturday at 9. Meenakshis mother visits padipura house and taunts padmavathy.
Parasparam 6 july 2015 to 11 july 2015 complete episodes. Parasparam 090316, asianet tv serial parasparam 2016 march 9 episode no 794, parasparam mar 03 watch online. I mean i never expected i will like the mal version of it, but lo i thoroughly enjoyed the episode. Parasparam 9316 parasparam 09 march 2016 episode 794. Parasparam serial latest episodes online can be watch through the app hotstar, parasparam is one of the most popular television serial airing on asianet. Sooraj is the apple of his mothers eye and the breadwinner of his family. Asianet showing parasparam serial on every monday to saturday at 9. Naagin 3 serial online 11082018 colors hindi tv naagin 3 hindi serial online 100818 naagin. Parasparam serial latest episodes from 22nd december to.
Asianet tv serial parasparam episode 439 08012015 asianet serial parasparam 08012015 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. Deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. Gayathri arun aka deepthi ips of parasparam serial makes silver screen debut. Gayathri arun newsolive gayathri arun is one of the most loved onscreen tiny surface actors for her duty deepthi ips. Watch parasparam tv serial 08 04 2016 parasparam april 8,2016 parasparam 0842016 hotstar malayalam tv serial parasparam 0842016 youtube watch parasparam last episode 08th april 2016 online asianet tv serial parasparam today parasparam lateset episode parasparam epi 820. A loving husband and a selfmade man, sooraj helps his ambitious wife deepthi achieve her dreams. Parasparam aired its last episode on august 31 and social media went. Malayalam serial parasparam actress deepthi fucking vedios porn movies. Obviously youre going to totally, utterly bring it on the wedding episode. Parasparam is a malayalmcommercial serial in asianet the beginning of serial i also a viewer of this serial.
Watch malayalam tv channel programmes, tele vision serials,chat talk shows online at. Sooraj warns deepthi to not eat or drink anything padmavati offers her, but deepthi pays no heed to his advice. Kailasanathan episode 419 31052014 may 31, 2014 kailasanathan is a teleserial based on legends of hindu god shiva. Deepthi ips rip parasparam serial troll parasparam last.
Mazhavil manorama malayalam serial ponnambili 18 july 2016 episode, ponnambili 19 july 2016 episode, ponnambili 20 july 2016 episode, ponnambili 21 july 2016 episode, ponnambili 22 july 2016 episode episode online. Parasparam serial actress gayathri arun wedding photos 12. The central character of serial parasparam is deepthi. Its the malayalam remake of the hindi serial diya aur baati hum. Mohena singh kumari on life after marriage, missing her yeh rishta. Parasparam is a 1983 indian malayalamlanguage film, directed by shajiyem and produced by jose brothers. Explore parasparam serial profile at times of india for photos, videos and latest news of parasparam serial. Episode 3 120814 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her. Comedy super nite s2 ep223 ambika pillai part02 full episode hd. Krishnan advices sooraj to focus on the marriage preparations rather than being depressed thinking about deepthi. Sneha posted a video on facebook following the news of her marriage. While everyone present were eagerly waiting for their deepthi ips and sooraj, essayed by gayathri arun and vivek gopan, the lead characters. Asianet parasparam serial actress gayathri arun fake whatsapp video,parasparam serial actress gayathri arun latest beautiful photos.
Shared video is a sequence between sneha and sreekumar of an old episode of the. Watch parasparam malayalam family tv series on hotstar premium now. Parasparam story revolves around the struggles of deepthi, a civil service aspirant. Parasparam watch episode 23 deepti marries suraj on. Deepthi is a home based and bright young girl who ambitions of becoming a truthful ias officer with help from her mother and father. Deepthi convinces dileeps mother to go ahead with the wedding in spite of suchitras failure in the exam. Though deepthi is angry at gopans decision, she gives in, on getting to know that her sisterinlaw is pregnant and is refusing to accompany gopan because she feels responsible for deepthi.
Parasparam that airs on asianet, is one of the most popular serials in malayalam and is nearing its 900th episode. Parasparam watch episode 33 the wedding plans change. The serial is mainly based on puranas and other epicbased works of mythologist devdutt pattanaik. Parasparam malayalam television mega serial online asianet. Vivek gopan and gayathri arun parasparam serial actress. Asianet serials parasparamkailasanathanswayamvaram. Shooting location paraspparam latest episode parasparam is ruling asianet channel since its beginning in the year 20. Asianet, mazhavil manorama, malayalam youtube, tv shows episode. As deepthi is an ips officer, i always knew that the last episode would have something dramatic or heroic and was prepared for anything. Its the top rated television serial now in malayalam television channels.
The serial begins with the story of lord shiva and sati, who is considered as the amshavtharpartial incarnation of the. Deepthi ips rip parasparam serial troll parasparam last episode. O99161 93212 indian free sex girls call monica friendship call me. After they reach home, they see the entire house flooded. Finally, padmavathi and her family welcome deepti home.
As deepthi is an ips officer, i always knew that the last episode would. This week serial is telecasting from episode 476 to 481. Why doesnt padmvathy want deepthi to become an ips officer. Meanwhile, sooraj is busy arranging the money for the wedding expenses. Gayathri arun aka deepthi ips of parasparam serial makes silver. Parasparam serial latest episodes on hotstar application. Parasparam serial latest episodes from 23rd february to. Parasparam serial last episode climaxparasparam deepthi bomb blast scene parasparam last episode troll video. Strapon fucking my boy please comment big black cock fucks white b0y. Episode 344 180914 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. This week serial is telecasting from episode 419 to 424. Asianet tv serial parasparam episode 362 9102014 asianet serial parasparam 91014 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. Is it the beauty of the story that makes every version of it beautiful. In the turn of events the girl sooraj is to marry elopes leaving padmavathi very angry at the wedding hall.
Dileeps mother drops in to announce that the wedding has to be postponed since he has been offered a job in america. Parasparam 18 december 2017 to 23 december 2017 complete. Parasparam 29 june 2015 to 4 july 2015 complete episodes hotstar video asianet parasparam serial 29062015 to 4072015 youtube videos admin 19. Parasparam serial is a remake of popular start plus serial diya aur baati hum. Serial actress gayathri arun deepthi ips, parasparam serial unseen after marriage video duration.
The film also has happy weddingfame anu sithara in a key role. Aarum ingne trollalle parasparam deepthi live gayathri. Ripped denim saree at veere di wedding promotions filmibeat. On seeing deepti upset, padmavathi consoles her and reminds her that she and her husband will be there for her. Parasparam 1917 parasparam 01 september 2017 episode. Malayalam serial parasparam actress deepthi fucking vedios. Gayathri arun aka deepthi ips of parasparam to debut in. There was the other sequence when the lead couples deepthi ips. Gayathri arun serial actress fucking free sex videos. Her brother gopan is tired of her dreams and desires to wed her into a good family. Goodbye parasparam, the malayalam serial that spawned a million. Parasparam 29 june 2015 to 4 july 2015 complete episodes. Portrays a of role deepthi the in airing parasparam ontv.
Parasparam 8 april 2016 8 4 16 asianet tv serial episode 820 online. Asianet tv serial parasparam episode 369 17102014 asianet serial parasparam 171014 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. Gayathri bagged the most popular actress award during the recently held asianet television awards 2016. Mallu actress rekha fucking with her costar indian mallu actress shobha fucking. Parasparam 6 july 2015 to 11 july 2015 complete episodes hotstar video asianet parasparam serial 6072015 to 11072015 youtube videos admin 00.
1299 114 671 416 150 213 73 1464 1540 886 521 1348 597 1103 719 1177 534 276 1147 679 1313 768 1279 1453 331 783 200 221 208 969 327 1348 787 838 184